PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00878.1.g00070.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 80aa    MW: 9200.64 Da    PI: 10.4552
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00878.1.g00070.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.3e-29958150
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                  krien++nrqvtfskRrng++KKA+ELSvLCd++va+++fs++g+l  +s
  Zpz_sc00878.1.g00070.1.sm.mk  9 KRIENNTNRQVTFSKRRNGLIKKAYELSVLCDIDVALLMFSPSGRLSHFS 58
                                  79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.324161IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.85E-31278IPR002100Transcription factor, MADS-box
CDDcd002651.17E-36275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MGRVKLPIKR IENNTNRQVT FSKRRNGLIK KAYELSVLCD IDVALLMFSP SGRLSHFSGR  60
HGVEDVVLRY MNLSEHDRGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-20175174Myocyte-specific enhancer factor 2B
1tqe_Q4e-20175174Myocyte-specific enhancer factor 2B
1tqe_R4e-20175174Myocyte-specific enhancer factor 2B
1tqe_S4e-20175174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565042e-90FM956504.1 Oryza sativa Japonica Group mRNA for MADS62 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649547.12e-50PREDICTED: agamous-like MADS-box protein AGL66
SwissprotQ1PFC21e-37AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLA2YWK79e-51A2YWK7_ORYSI; Putative uncharacterized protein
TrEMBLI1QJS19e-51I1QJS1_ORYGL; Uncharacterized protein
TrEMBLQ6Z5F89e-51Q6Z5F8_ORYSJ; Os08g0494100 protein
STRINGBGIOSGA026745-PA2e-50(Oryza sativa Indica Group)
STRINGLOC_Os08g38590.12e-50(Oryza sativa Japonica Group)
STRINGORGLA08G0167200.12e-50(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.17e-39AGAMOUS-like 66